Lineage for d1tuyb1 (1tuy B:1-197)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 995076Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 995077Superfamily c.55.1: Actin-like ATPase domain [53067] (14 families) (S)
    duplication contains two domains of this fold
  5. 995385Family c.55.1.2: Acetokinase-like [53080] (3 proteins)
  6. 995386Protein Acetate kinase [53081] (1 species)
  7. 995387Species Methanosarcina thermophila [TaxId:2210] [53082] (3 PDB entries)
    Uniprot P38502 1-399
  8. 995398Domain d1tuyb1: 1tuy B:1-197 [112668]
    complexed with acy, adp, af3, so4

Details for d1tuyb1

PDB Entry: 1tuy (more details), 3 Å

PDB Description: Acetate Kinase complexed with ADP, AlF3 and acetate
PDB Compounds: (B:) acetate kinase

SCOPe Domain Sequences for d1tuyb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tuyb1 c.55.1.2 (B:1-197) Acetate kinase {Methanosarcina thermophila [TaxId: 2210]}
mkvlvinagssslkyqlidmtnesalavglcerigidnsiitqkkfdgkklekltdlpth
kdaleevvkaltddefgvikdmgeinavghrvvhggekfttsalydegvekaikdcfela
plhnppnmmgisacaeimpgtpmvivfdtafhqtmppyaymyalpydlyekhgvrkygfh
gtshkyvaeraalmlgk

SCOPe Domain Coordinates for d1tuyb1:

Click to download the PDB-style file with coordinates for d1tuyb1.
(The format of our PDB-style files is described here.)

Timeline for d1tuyb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1tuyb2