| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (14 families) ![]() duplication contains two domains of this fold |
| Family c.55.1.2: Acetokinase-like [53080] (3 proteins) |
| Protein Acetate kinase [53081] (1 species) |
| Species Methanosarcina thermophila [TaxId:2210] [53082] (3 PDB entries) Uniprot P38502 1-399 |
| Domain d1tuya1: 1tuy A:1-197 [112666] complexed with acy, adp, af3, so4 |
PDB Entry: 1tuy (more details), 3 Å
SCOPe Domain Sequences for d1tuya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tuya1 c.55.1.2 (A:1-197) Acetate kinase {Methanosarcina thermophila [TaxId: 2210]}
mkvlvinagssslkyqlidmtnesalavglcerigidnsiitqkkfdgkklekltdlpth
kdaleevvkaltddefgvikdmgeinavghrvvhggekfttsalydegvekaikdcfela
plhnppnmmgisacaeimpgtpmvivfdtafhqtmppyaymyalpydlyekhgvrkygfh
gtshkyvaeraalmlgk
Timeline for d1tuya1: