SCOPe 2.07: Domain d1tqeq_: 1tqe Q:

Lineage for d1tqeq_ (1tqe Q:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.88: SRF-like [55454] (1 superfamily)
   alpha-beta(2)-alpha; dimer; 3 layers a/b/a; antiparallel beta-sheet

4. Superfamily d.88.1: SRF-like [55455] (1 family)

5. Family d.88.1.1: SRF-like [55456] (5 proteins)

6. Protein Myocyte enhancer factor Mef2b core [103117] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [103118] (3 PDB entries)
   Uniprot Q02080 2-91

8. Domain d1tqeq_: 1tqe Q: [112610]
   complexed with Histone deacetylase 9 peptide (Uniprot Q9UKV0 139-155), chains X and Y
   protein/DNA complex

Details for d1tqeq_

PDB Entry: 1tqe, 2.7 Å

PDB Description: mechanism of recruitment of class ii histone deacetylases by myocyte enhancer factor-2

PDB Compounds: (Q:) Myocyte-specific enhancer factor 2B

SCOPe Domain Sequences for d1tqeq_:

Sequence; same for both SEQRES and ATOM records:

>d1tqeq_ d.88.1.1 (Q:) Myocyte enhancer factor Mef2b core {Human (Homo sapiens) [TaxId: 9606]}
grkkiqisrildqrnrqvtftkrkfglmkkayelsvlcdceialiifnsanrlfqyastd
mdrvllkyteysephesrtntdiletlkrr

Timeline for d1tqeq_:

• d1tqeq_ first appeared in SCOP 1.71
  
• d1tqeq_ appears in SCOPe 2.06
  
• d1tqeq_ appears in the current release, SCOPe 2.08