PDB entry 1tqe

View 1tqe on RCSB PDB site
Description: Mechanism of recruitment of class II histone deacetylases by myocyte enhancer factor-2
Class: transcription/protein binding/DNA
Keywords: MEF2, HDAC, co-repressor, transcription, TRANSCRIPTION-PROTEIN BINDING-DNA COMPLEX
Deposited on 2004-06-17, released 2004-12-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'C':
    Compound: MEF2 binding site of nur77 promoter
  • Chain 'D':
    Compound: MEF2 binding site of nur77 promoter
  • Chain 'E':
    Compound: MEF2 binding site of nur77 promoter
  • Chain 'F':
    Compound: MEF2 binding site of nur77 promoter
  • Chain 'P':
    Compound: Myocyte-specific enhancer factor 2B
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tqep_
  • Chain 'Q':
    Compound: Myocyte-specific enhancer factor 2B
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tqeq_
  • Chain 'R':
    Compound: Myocyte-specific enhancer factor 2B
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tqer_
  • Chain 'S':
    Compound: Myocyte-specific enhancer factor 2B
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tqes_
  • Chain 'X':
    Compound: Histone deacetylase 9
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99N13 (5-End)
      • cloning artifact (0-4)
      • conflict (5)
  • Chain 'Y':
    Compound: Histone deacetylase 9
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99N13 (5-End)
      • cloning artifact (0-4)
      • conflict (5)

PDB Chain Sequences:

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >1tqeP (P:)
    mgrkkiqisrildqrnrqvtftkrkfglmkkayelsvlcdceialiifnsanrlfqyast
    dmdrvllkyteysephesrtntdiletlkrrgi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tqeP (P:)
    grkkiqisrildqrnrqvtftkrkfglmkkayelsvlcdceialiifnsanrlfqyastd
    mdrvllkyteysephesrtntdiletlkrr
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >1tqeQ (Q:)
    mgrkkiqisrildqrnrqvtftkrkfglmkkayelsvlcdceialiifnsanrlfqyast
    dmdrvllkyteysephesrtntdiletlkrrgi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tqeQ (Q:)
    grkkiqisrildqrnrqvtftkrkfglmkkayelsvlcdceialiifnsanrlfqyastd
    mdrvllkyteysephesrtntdiletlkrr
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >1tqeR (R:)
    mgrkkiqisrildqrnrqvtftkrkfglmkkayelsvlcdceialiifnsanrlfqyast
    dmdrvllkyteysephesrtntdiletlkrrgi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tqeR (R:)
    grkkiqisrildqrnrqvtftkrkfglmkkayelsvlcdceialiifnsanrlfqyastd
    mdrvllkyteysephesrtntdiletlkrr
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >1tqeS (S:)
    mgrkkiqisrildqrnrqvtftkrkfglmkkayelsvlcdceialiifnsanrlfqyast
    dmdrvllkyteysephesrtntdiletlkrrgi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tqeS (S:)
    grkkiqisrildqrnrqvtftkrkfglmkkayelsvlcdceialiifnsanrlfqyastd
    mdrvllkyteysephesrtntdiletlkrr
    

  • Chain 'X':
    No sequence available.

  • Chain 'Y':
    No sequence available.