Lineage for d1tnbk_ (1tnb K:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 1501202Superfamily a.118.6: Protein prenylyltransferase [48439] (1 family) (S)
  5. 1501203Family a.118.6.1: Protein prenylyltransferase [48440] (3 proteins)
  6. 1501204Protein Protein farnesyltransferase alpha-subunit [48441] (2 species)
  7. 1501219Species Norway rat (Rattus norvegicus) [TaxId:10116] [48442] (51 PDB entries)
    Uniprot Q04631 55-369
  8. 1501299Domain d1tnbk_: 1tnb K: [112543]
    Other proteins in same PDB: d1tnbb_, d1tnbd_, d1tnbf_, d1tnbh_, d1tnbj_, d1tnbl_
    complexed with cl, mes, mgm, zn

Details for d1tnbk_

PDB Entry: 1tnb (more details), 2.85 Å

PDB Description: rat protein geranylgeranyltransferase type-i complexed with a ggpp analog and a substrate kksktkcvif peptide derived from tc21
PDB Compounds: (K:) geranylgeranyltransferase type I alpha subunit

SCOPe Domain Sequences for d1tnbk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tnbk_ a.118.6.1 (K:) Protein farnesyltransferase alpha-subunit {Norway rat (Rattus norvegicus) [TaxId: 10116]}
flsldsptyvlyrdraewadidpvpqndgpspvvqiiysekfrdvydyfravlqrderse
rafkltrdaielnaanytvwhfrrvllrslqkdlqeemnyiiaiieeqpknyqvwhhrrv
lvewlkdpsqelefiadilnqdaknyhawqhrqwviqefrlwdnelqyvdqllkedvrnn
svwnqrhfvisnttgysdravlerevqytlemiklvphnesawnylkgilqdrglsrypn
llnqlldlqpshsspyliaflvdiyedmlenqcdnkedilnkalelceilakekdtirke
ywryigrslqskhs

SCOPe Domain Coordinates for d1tnbk_:

Click to download the PDB-style file with coordinates for d1tnbk_.
(The format of our PDB-style files is described here.)

Timeline for d1tnbk_: