Lineage for d1tezc2 (1tez C:2-204)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1161627Fold c.28: Cryptochrome/photolyase, N-terminal domain [52424] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like
  4. 1161628Superfamily c.28.1: Cryptochrome/photolyase, N-terminal domain [52425] (1 family) (S)
  5. 1161629Family c.28.1.1: Cryptochrome/photolyase, N-terminal domain [52426] (2 proteins)
  6. 1161637Protein DNA photolyase [52427] (3 species)
    binds a light-harvesting cofactor
  7. 1161641Species Synechococcus elongatus [TaxId:32046] [52429] (7 PDB entries)
    Uniprot P05327 1-474
    cofactor is HDF
  8. 1161645Domain d1tezc2: 1tez C:2-204 [112414]
    Other proteins in same PDB: d1teza1, d1tezb1, d1tezc1, d1tezd1
    protein/DNA complex; complexed with fad, hdf, mg, tcp

Details for d1tezc2

PDB Entry: 1tez (more details), 1.8 Å

PDB Description: complex between dna and the dna photolyase from anacystis nidulans
PDB Compounds: (C:) Deoxyribodipyrimidine photolyase

SCOPe Domain Sequences for d1tezc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tezc2 c.28.1.1 (C:2-204) DNA photolyase {Synechococcus elongatus [TaxId: 32046]}
aapilfwhrrdlrlsdniglaaaraqsaqliglfcldpqilqsadmaparvaylqgclqe
lqqryqqagsrllllqgdpqhlipqlaqqlqaeavywnqdiepygrdrdgqvaaalktag
iravqlwdqllhspdqilsgsgnpysvygpfwknwqaqpkptpvatptelvdlspeqlta
iaplllselptlkqlgfdwdggf

SCOPe Domain Coordinates for d1tezc2:

Click to download the PDB-style file with coordinates for d1tezc2.
(The format of our PDB-style files is described here.)

Timeline for d1tezc2: