SCOP 1.71: Domain d1tezc2: 1tez C:2-204

Lineage for d1tezc2 (1tez C:2-204)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.28: Cryptochrome/photolyase, N-terminal domain [52424] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like

4. Superfamily c.28.1: Cryptochrome/photolyase, N-terminal domain [52425] (1 family)

5. Family c.28.1.1: Cryptochrome/photolyase, N-terminal domain [52426] (2 proteins)

6. Protein DNA photolyase [52427] (3 species)
   binds a light-harvesting cofactor

7. Species Anacystis nidulans [52429] (7 PDB entries)
   cofactor is HDF

8. Domain d1tezc2: 1tez C:2-204 [112414]
   Other proteins in same PDB: d1teza1, d1tezb1, d1tezc1, d1tezd1

Details for d1tezc2

PDB Entry: 1tez, 1.8 Å

PDB Description: complex between dna and the dna photolyase from anacystis nidulans

SCOP Domain Sequences for d1tezc2:

Sequence; same for both SEQRES and ATOM records:

>d1tezc2 c.28.1.1 (C:2-204) DNA photolyase {Anacystis nidulans}
aapilfwhrrdlrlsdniglaaaraqsaqliglfcldpqilqsadmaparvaylqgclqe
lqqryqqagsrllllqgdpqhlipqlaqqlqaeavywnqdiepygrdrdgqvaaalktag
iravqlwdqllhspdqilsgsgnpysvygpfwknwqaqpkptpvatptelvdlspeqlta
iaplllselptlkqlgfdwdggf

Timeline for d1tezc2:

• d1tezc2 is new in SCOP 1.71
  
• d1tezc2 appears in SCOP 1.73
  
• d1tezc2 appears in the current release, SCOPe 2.08