Lineage for d1tdla_ (1tdl A:)

  1. Root: SCOPe 2.02
  2. 1232558Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 1232773Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 1232774Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 1232775Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 1232943Protein beta-Lactamase, class A [56606] (15 species)
  7. 1233023Species Klebsiella pneumoniae, SHV-1 [TaxId:573] [56609] (20 PDB entries)
    inhibited by tazobactam
    Uniprot Q5PSW7 ! Uniprot P14557 22-286
  8. 1233037Domain d1tdla_: 1tdl A: [112398]
    complexed with epe, ma4

Details for d1tdla_

PDB Entry: 1tdl (more details), 1.8 Å

PDB Description: structure of ser130gly shv-1 beta-lactamase
PDB Compounds: (A:) Beta-lactamase SHV-1

SCOPe Domain Sequences for d1tdla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tdla_ e.3.1.1 (A:) beta-Lactamase, class A {Klebsiella pneumoniae, SHV-1 [TaxId: 573]}
spqpleqiklsesqlsgrvgmiemdlasgrtltawraderfpmmstfkvvlcgavlarvd
agdeqlerkihyrqqdlvdyspvsekhladgmtvgelcaaaitmgdnsaanlllatvggp
agltaflrqigdnvtrldrwetelnealpgdardtttpasmaatlrklltsqrlsarsqr
qllqwmvddrvagplirsvlpagwfiadktgagergargivallgpnnkaerivviylrd
tpasmaernqqiagigaaliehwqr

SCOPe Domain Coordinates for d1tdla_:

Click to download the PDB-style file with coordinates for d1tdla_.
(The format of our PDB-style files is described here.)

Timeline for d1tdla_: