SCOP 1.71: Domain d1tdla_: 1tdl A:

Lineage for d1tdla_ (1tdl A:)

1. Root: SCOP 1.71

2. Class e: Multi-domain proteins (alpha and beta) [56572] (48 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (2 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (13 proteins)

6. Protein beta-Lactamase, class A [56606] (15 species)

7. Species Klebsiella pneumoniae, SHV-1 [TaxId:573] [56609] (7 PDB entries)
   inhibited by tazobactam

8. Domain d1tdla_: 1tdl A: [112398]
   complexed with epe, ma4; mutant

Details for d1tdla_

PDB Entry: 1tdl, 1.8 Å

PDB Description: structure of ser130gly shv-1 beta-lactamase

SCOP Domain Sequences for d1tdla_:

Sequence; same for both SEQRES and ATOM records:

>d1tdla_ e.3.1.1 (A:) beta-Lactamase, class A {Klebsiella pneumoniae, SHV-1}
spqpleqiklsesqlsgrvgmiemdlasgrtltawraderfpmmstfkvvlcgavlarvd
agdeqlerkihyrqqdlvdyspvsekhladgmtvgelcaaaitmgdnsaanlllatvggp
agltaflrqigdnvtrldrwetelnealpgdardtttpasmaatlrklltsqrlsarsqr
qllqwmvddrvagplirsvlpagwfiadktgagergargivallgpnnkaerivviylrd
tpasmaernqqiagigaaliehwqr

Timeline for d1tdla_:

• d1tdla_ is new in SCOP 1.71
  
• d1tdla_ appears in SCOP 1.73
  
• d1tdla_ appears in the current release, SCOPe 2.08