Lineage for d1t9ha1 (1t9h A:1-67)
- Root: SCOP 1.73
Class b: All beta proteins [48724] (165 folds) 
Fold b.40: OB-fold [50198] (12 superfamilies)
barrel, closed or partly opened n=5, S=10 or S=8; greek-key
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (14 families) 
Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (22 proteins)
barrel, closed; n=5, S=8
Protein Probable GTPase EngC (YjeQ), N-terminal domain [110200] (2 species) Species Bacillus subtilis [TaxId:1423] [117197] (1 PDB entry) 
Domain d1t9ha1: 1t9h A:1-67 [112358]
Other proteins in same PDB: d1t9ha2
complexed with act, ca, ium, zn
Details for d1t9ha1
PDB Entry: 1t9h (more details), 1.6 Å
PDB Description: The crystal structure of YloQ, a circularly permuted GTPase.
PDB Compounds: (A:) Probable GTPase engCSCOP Domain Sequences for d1t9ha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t9ha1 b.40.4.5 (A:1-67) Probable GTPase EngC (YjeQ), N-terminal domain {Bacillus subtilis [TaxId: 1423]}
mpegkiikalsgfyyvldesedsdkviqcrgrgifrknkitplvgdyvvyqaendkegyl
meikert
SCOP Domain Coordinates for d1t9ha1:
Click to download the PDB-style file with coordinates for d1t9ha1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1t9ha1:
- d1t9ha1 first appeared in SCOP 1.71
- d1t9ha1 appears in SCOP 1.75
- d1t9ha1 appears in the current release, SCOPe 2.08
View in 3D
