Lineage for d1t80a1 (1t80 A:184-277)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2356941Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2361198Protein Zinc-alpha-2-glycoprotein, ZAG, alpha-3 domain [48965] (1 species)
    fat depleting factor related to class I MHC
  7. 2361199Species Human (Homo sapiens) [TaxId:9606] [48966] (8 PDB entries)
    Uniprot P25311 22-294
  8. 2361201Domain d1t80a1: 1t80 A:184-277 [112312]
    Other proteins in same PDB: d1t80a2
    complexed with nag

Details for d1t80a1

PDB Entry: 1t80 (more details), 2.1 Å

PDB Description: zn-alpha-2-glycoprotein; cho-zag peg 200
PDB Compounds: (A:) Zinc-alpha-2-glycoprotein

SCOPe Domain Sequences for d1t80a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t80a1 b.1.1.2 (A:184-277) Zinc-alpha-2-glycoprotein, ZAG, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]}
qdppsvvvtshqapgekkklkclaydfypgkidvhwtragevqepelrgdvlhngngtyq
swvvvavppqdtapyschvqhsslaqplvvpwea

SCOPe Domain Coordinates for d1t80a1:

Click to download the PDB-style file with coordinates for d1t80a1.
(The format of our PDB-style files is described here.)

Timeline for d1t80a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1t80a2