Lineage for d1t80a1 (1t80 A:184-277)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) 
Protein Zinc-alpha-2-glycoprotein, ZAG, alpha-3 domain [48965] (1 species)
fat depleting factor related to class I MHCSpecies Human (Homo sapiens) [TaxId:9606] [48966] (8 PDB entries)
Uniprot P25311 22-294
Domain d1t80a1: 1t80 A:184-277 [112312]
Other proteins in same PDB: d1t80a2
complexed with nag
Details for d1t80a1
PDB Entry: 1t80 (more details), 2.1 Å
PDB Description: zn-alpha-2-glycoprotein; cho-zag peg 200
PDB Compounds: (A:) Zinc-alpha-2-glycoproteinSCOPe Domain Sequences for d1t80a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t80a1 b.1.1.2 (A:184-277) Zinc-alpha-2-glycoprotein, ZAG, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]}
qdppsvvvtshqapgekkklkclaydfypgkidvhwtragevqepelrgdvlhngngtyq
swvvvavppqdtapyschvqhsslaqplvvpwea
SCOPe Domain Coordinates for d1t80a1:
Click to download the PDB-style file with coordinates for d1t80a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1t80a1:
- d1t80a1 first appeared in SCOP 1.71
- d1t80a1 appears in SCOPe 2.07
View in 3D
