SCOP 1.71: Domain d1t6sb1: 1t6s B:1-85

Lineage for d1t6sb1 (1t6s B:1-85)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (61 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.60: ScpB/YpuH-like [116804] (1 protein)
   Pfam 04079
   duplication: tandem repeat of two 'winged helix' domains; forms a dimer via the C-terminal domain

6. Protein Segregation and condensation protein B, ScpB [116805] (1 species)

7. Species Chlorobium tepidum [TaxId:1097] [116806] (1 PDB entry)

8. Domain d1t6sb1: 1t6s B:1-85 [112273]

Details for d1t6sb1

PDB Entry: 1t6s, 1.95 Å

PDB Description: Crystal structure of a conserved hypothetical protein from Chlorobium tepidum

SCOP Domain Sequences for d1t6sb1:

Sequence; same for both SEQRES and ATOM records:

>d1t6sb1 a.4.5.60 (B:1-85) Segregation and condensation protein B, ScpB {Chlorobium tepidum}
mqeqrqqllrslealifsseepvnlqtlsqitahkftpselqeavdelnrdyeatgrtfr
ihaiaggyrfltepefadlvrqlla

Timeline for d1t6sb1:

• d1t6sb1 is new in SCOP 1.71
  
• d1t6sb1 appears in SCOP 1.73
  
• d1t6sb1 appears in the current release, SCOPe 2.08