PDB entry 1t6s

View 1t6s on RCSB PDB site
Description: Crystal structure of a conserved hypothetical protein from Chlorobium tepidum
Deposited on 2004-05-07, released 2004-12-07
The last revision prior to the SCOP 1.71 freeze date was dated 2004-12-07, with a file datestamp of 2004-12-07.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.216
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1t6sA (A:)
    mqeqrqqllrslealifsseepvnlqtlsqitahkftpselqeavdelnrdyeatgrtfr
    ihaiaggyrfltepefadlvrqllapviqrrlsrsmlevlavvawhqpvtkgeiqqirga
    spdysidrllarglievrgradspgrplqygttevfldlfhl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1t6sB (B:)
    mqeqrqqllrslealifsseepvnlqtlsqitahkftpselqeavdelnrdyeatgrtfr
    ihaiaggyrfltepefadlvrqllapviqrrlsrsmlevlavvawhqpvtkgeiqqirga
    spdysidrllarglievrgradspgrplqygttevfldlfhl