Lineage for d1t6sa2 (1t6s A:86-162)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 532780Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 533238Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (61 families) (S)
    contains a small beta-sheet (wing)
  5. 533946Family a.4.5.60: ScpB/YpuH-like [116804] (1 protein)
    Pfam 04079
    duplication: tandem repeat of two 'winged helix' domains; forms a dimer via the C-terminal domain
  6. 533947Protein Segregation and condensation protein B, ScpB [116805] (1 species)
  7. 533948Species Chlorobium tepidum [TaxId:1097] [116806] (1 PDB entry)
  8. 533950Domain d1t6sa2: 1t6s A:86-162 [112272]

Details for d1t6sa2

PDB Entry: 1t6s (more details), 1.95 Å

PDB Description: Crystal structure of a conserved hypothetical protein from Chlorobium tepidum

SCOP Domain Sequences for d1t6sa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t6sa2 a.4.5.60 (A:86-162) Segregation and condensation protein B, ScpB {Chlorobium tepidum}
pviqrrlsrsmlevlavvawhqpvtkgeiqqirgaspdysidrllarglievrgradspg
rplqygttevfldlfhl

SCOP Domain Coordinates for d1t6sa2:

Click to download the PDB-style file with coordinates for d1t6sa2.
(The format of our PDB-style files is described here.)

Timeline for d1t6sa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1t6sa1