SCOPe 2.08: Domain d1t4ya1: 1t4y A:3-102

Lineage for d1t4ya1 (1t4y A:3-102)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.15: KaiB-like [102449] (3 proteins)
   Pfam PF07689; contains members with alternative folds

6. Protein Adaptive-response sensory-kinase SasA, N-terminal domain [117596] (1 species)
   has a canonical thioredoxin fold

7. Species Synechococcus elongatus [TaxId:32046] [117597] (2 PDB entries)
   Uniprot Q06904 19-109 # 97% sequence identity

8. Domain d1t4ya1: 1t4y A:3-102 [112248]
   Other proteins in same PDB: d1t4ya2, d1t4ya3

Details for d1t4ya1

PDB Entry: 1t4y

PDB Description: Solution structure of the N-terminal domain of Synechococcus elongatus SasA (average minimized structure)

PDB Compounds: (A:) Adaptive-response sensory-kinase sasA

SCOPe Domain Sequences for d1t4ya1:

Sequence; same for both SEQRES and ATOM records:

>d1t4ya1 c.47.1.15 (A:3-102) Adaptive-response sensory-kinase SasA, N-terminal domain {Synechococcus elongatus [TaxId: 32046]}
slspqalaqplllqlfvdtrplsqhivqrvknilaaveatvpislqvinvadqpqlveyy
rlvvtpalvkigpgsrqvlsgidltdqlanqlpqwlvqqe

Timeline for d1t4ya1:

• d1t4ya1 first appeared in SCOP 1.71, called d1t4ya_
  
• d1t4ya1 appears in SCOPe 2.07