Lineage for d1t4ya_ (1t4y A:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 584500Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 584501Superfamily c.47.1: Thioredoxin-like [52833] (16 families) (S)
  5. 585439Family c.47.1.15: KaiB-like [102449] (2 proteins)
    Pfam 07689; contains members with alternative folds
  6. 585440Protein Adaptive-response sensory-kinase SasA, N-terminal domain [117596] (1 species)
    has a canonical thioredoxin fold
  7. 585441Species Synechococcus elongatus [TaxId:32046] [117597] (2 PDB entries)
  8. 585443Domain d1t4ya_: 1t4y A: [112248]

Details for d1t4ya_

PDB Entry: 1t4y (more details)

PDB Description: Solution structure of the N-terminal domain of Synechococcus elongatus SasA (average minimized structure)

SCOP Domain Sequences for d1t4ya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t4ya_ c.47.1.15 (A:) Adaptive-response sensory-kinase SasA, N-terminal domain {Synechococcus elongatus}
gsslspqalaqplllqlfvdtrplsqhivqrvknilaaveatvpislqvinvadqpqlve
yyrlvvtpalvkigpgsrqvlsgidltdqlanqlpqwlvqqegif

SCOP Domain Coordinates for d1t4ya_:

Click to download the PDB-style file with coordinates for d1t4ya_.
(The format of our PDB-style files is described here.)

Timeline for d1t4ya_: