PDB entry 1t4y

View 1t4y on RCSB PDB site
Description: Solution structure of the N-terminal domain of Synechococcus elongatus SasA (average minimized structure)
Class: transferase
Keywords: Alpha/Beta protein, Thioredoxin fold, TRANSFERASE
Deposited on 2004-04-30, released 2004-11-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Adaptive-response sensory-kinase sasA
    Species: SYNECHOCOCCUS ELONGATUS [TaxId:1140]
    Gene: SASA, SARS
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q06904 (2-101)
      • cloning artifact (0-1)
      • cloning artifact (102-104)
    Domains in SCOPe 2.08: d1t4ya1, d1t4ya2, d1t4ya3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1t4yA (A:)
gsslspqalaqplllqlfvdtrplsqhivqrvknilaaveatvpislqvinvadqpqlve
yyrlvvtpalvkigpgsrqvlsgidltdqlanqlpqwlvqqegif