Lineage for d1t3wb_ (1t3w B:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 928379Fold a.236: DNA primase DnaG, C-terminal domain [117022] (1 superfamily)
    multihelical; segment-swapped dimer
  4. 928380Superfamily a.236.1: DNA primase DnaG, C-terminal domain [117023] (1 family) (S)
  5. 928381Family a.236.1.1: DNA primase DnaG, C-terminal domain [117024] (1 protein)
  6. 928382Protein DNA primase DnaG, C-terminal domain [117025] (1 species)
  7. 928383Species Escherichia coli [TaxId:562] [117026] (2 PDB entries)
    Uniprot P02923 447-580 # structure of the core domain (115-427) is also known, (56734)
  8. 928385Domain d1t3wb_: 1t3w B: [112234]
    complexed with acy

Details for d1t3wb_

PDB Entry: 1t3w (more details), 2.8 Å

PDB Description: crystal structure of the e.coli dnag c-terminal domain (residues 434 to 581)
PDB Compounds: (B:) DNA primase

SCOPe Domain Sequences for d1t3wb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t3wb_ a.236.1.1 (B:) DNA primase DnaG, C-terminal domain {Escherichia coli [TaxId: 562]}
krttmriligllvqnpelatlvpplenldenklpglglfrelvntclsqpglttgqlleh
yrgtnnaatleklsmwddiadkniaeqtftdslnhmfdsllelrqeeliarerthglsne
erlelwtlnqelakk

SCOPe Domain Coordinates for d1t3wb_:

Click to download the PDB-style file with coordinates for d1t3wb_.
(The format of our PDB-style files is described here.)

Timeline for d1t3wb_: