SCOPe 2.07: Domain d1t0oa2: 1t0o A:1-314

Lineage for d1t0oa2 (1t0o A:1-314)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
   members of the family may contain various insert subdomains
   in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain

6. Protein Melibiase [75064] (4 species)

7. Species Trichoderma reesei [TaxId:51453] [110349] (2 PDB entries)
   Alpha-galactosidase agl1
   Uniprot Q92456

8. Domain d1t0oa2: 1t0o A:1-314 [112212]
   Other proteins in same PDB: d1t0oa1
   complexed with gal

Details for d1t0oa2

PDB Entry: 1t0o, 1.96 Å

PDB Description: the structure of alpha-galactosidase from trichoderma reesei complexed with beta-d-galactose

PDB Compounds: (A:) alpha-galactosidase

SCOPe Domain Sequences for d1t0oa2:

Sequence; same for both SEQRES and ATOM records:

>d1t0oa2 c.1.8.1 (A:1-314) Melibiase {Trichoderma reesei [TaxId: 51453]}
ivmpdgvtgkvpslgwnswnayhcdideskflsaaelivssglldagynyvniddcwsmk
dgrvdghiapnatrfpdgidglakkvhalglklgiystagtatcagypaslgyedvdaad
fadwgvdylkydncnvpsdwqdeyvacnpdfvktgpngtcttaldptlappgydwstsks
aerfgamrnalakqsheivlsmciwgqadvfswgnstgiswrmsddispnwgsvtrilnl
nsfklnsvdfwghndadmlevgngnltaaetrthfalwaamksplligtdlaqlsqnnin
llknkhllafnqds

Timeline for d1t0oa2:

• d1t0oa2 first appeared in SCOP 1.71
  
• d1t0oa2 appears in SCOPe 2.06
  
• d1t0oa2 appears in the current release, SCOPe 2.08