Lineage for d1t0oa2 (1t0o A:1-314)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 570217Fold c.1: TIM beta/alpha-barrel [51350] (32 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 571086Superfamily c.1.8: (Trans)glycosidases [51445] (13 families) (S)
  5. 571087Family c.1.8.1: Amylase, catalytic domain [51446] (24 proteins)
    members of the family may contain various insert subdomains
    in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
  6. 571409Protein Melibiase [75064] (4 species)
  7. 571420Species Trichoderma reesei [TaxId:51453] [110349] (2 PDB entries)
    Alpha-galactosidase agl1
  8. 571422Domain d1t0oa2: 1t0o A:1-314 [112212]
    Other proteins in same PDB: d1t0oa1
    complexed with glb, man, nag

Details for d1t0oa2

PDB Entry: 1t0o (more details), 1.96 Å

PDB Description: The structure of alpha-galactosidase from Trichoderma reesei complexed with beta-D-galactose

SCOP Domain Sequences for d1t0oa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t0oa2 c.1.8.1 (A:1-314) Melibiase {Trichoderma reesei}
ivmpdgvtgkvpslgwnswnayhcdideskflsaaelivssglldagynyvniddcwsmk
dgrvdghiapnatrfpdgidglakkvhalglklgiystagtatcagypaslgyedvdaad
fadwgvdylkydncnvpsdwqdeyvacnpdfvktgpngtcttaldptlappgydwstsks
aerfgamrnalakqsheivlsmciwgqadvfswgnstgiswrmsddispnwgsvtrilnl
nsfklnsvdfwghndadmlevgngnltaaetrthfalwaamksplligtdlaqlsqnnin
llknkhllafnqds

SCOP Domain Coordinates for d1t0oa2:

Click to download the PDB-style file with coordinates for d1t0oa2.
(The format of our PDB-style files is described here.)

Timeline for d1t0oa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1t0oa1