Lineage for d1t0ne_ (1t0n E:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2020524Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 protein domains)
  6. 2020525Protein beta2-microglobulin [88600] (5 species)
  7. 2021164Species Mouse (Mus musculus) [TaxId:10090] [88603] (175 PDB entries)
    Uniprot P01887
  8. 2021188Domain d1t0ne_: 1t0n E: [112210]
    Other proteins in same PDB: d1t0na1, d1t0na2, d1t0nd1, d1t0nd2

Details for d1t0ne_

PDB Entry: 1t0n (more details), 1.8 Å

PDB Description: Conformational switch in polymorphic H-2K molecules containing an HSV peptide
PDB Compounds: (E:) Beta-2-microglobulin

SCOPe Domain Sequences for d1t0ne_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t0ne_ b.1.1.2 (E:) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

SCOPe Domain Coordinates for d1t0ne_:

Click to download the PDB-style file with coordinates for d1t0ne_.
(The format of our PDB-style files is described here.)

Timeline for d1t0ne_: