Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species) |
Species Mouse (Mus musculus), H-2KB [TaxId:10090] [54481] (52 PDB entries) Uniprot P01901 22-299 |
Domain d1t0nd2: 1t0n D:1-181 [112209] Other proteins in same PDB: d1t0na1, d1t0nb_, d1t0nd1, d1t0ne_ |
PDB Entry: 1t0n (more details), 1.8 Å
SCOPe Domain Sequences for d1t0nd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t0nd2 d.19.1.1 (D:1-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2KB [TaxId: 10090]} gphslryfvtavsrpglgeprfisvgyvdntefvrfdsdaenpryeprarwmeqegpeyw eretqkakgneqsfrvdlrtllgyynqskggshtiqvisgcevgsdgrllrgyqqyaydg cdyialnedlktwtaadmaalitkhkweqageaerlraylegtcvewlrrylkngnatll r
Timeline for d1t0nd2:
View in 3D Domains from other chains: (mouse over for more information) d1t0na1, d1t0na2, d1t0nb_, d1t0ne_ |