| Class b: All beta proteins [48724] (149 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
| Protein beta2-microglobulin [88600] (4 species) |
| Species Mouse (Mus musculus) [TaxId:10090] [88603] (66 PDB entries) |
| Domain d1t0ne_: 1t0n E: [112210] Other proteins in same PDB: d1t0na1, d1t0na2, d1t0nd1, d1t0nd2 |
PDB Entry: 1t0n (more details), 1.8 Å
SCOP Domain Sequences for d1t0ne_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t0ne_ b.1.1.2 (E:) beta2-microglobulin {Mouse (Mus musculus)}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm
Timeline for d1t0ne_: