Lineage for d1sxil_ (1sxi L:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. Family c.93.1.1: L-arabinose binding protein-like [53823] (18 proteins)
    has additional insertions and/or extensions that are not grouped together
  6. Protein Glucose-resistance amylase regulator CcpA, C-terminal domain [117740] (2 species)
  7. Species Bacillus megaterium [TaxId:1404] [117741] (10 PDB entries)
    Uniprot P46828 58-322 ! Uniprot P46828
  8. Domain d1sxil_: 1sxi L: [112155]
    complexed with mg

Details for d1sxil_

PDB Entry: 1sxi (more details), 3 Å

PDB Description: Structure of apo transcription regulator B. megaterium
PDB Compounds: (L:) Glucose-resistance amylase regulator

SCOPe Domain Sequences for d1sxil_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sxil_ c.93.1.1 (L:) Glucose-resistance amylase regulator CcpA, C-terminal domain {Bacillus megaterium [TaxId: 1404]}
tttvgviipdisnifyaelargiediatmykyniilsnsdqnqdkelhllnnmlgkqvdg
iifmsgnvteehveelkkspvpvvlaasiestnqipsvtidyeqaafdavqslidsghkn
iafvsgtleepinhakkvkgykraltesglpvrdsyivegdytydsgieaveklleedek
ptaifvgtdemalgvihgaqdrglnvpndleiigfdntrlstmvrpqltsvvqpmydiga
vamrlltkymnketvdssivqlphriefrqstk

SCOPe Domain Coordinates for d1sxil_ are not available.

Timeline for d1sxil_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1sxia_, d1sxib_, d1sxid_, d1sxig_, d1sxii_, d1sxik_, d1sxim_, d1sxin_, d1sxir_, d1sxit_, d1sxiw_