Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication parallel beta-sheet of 6 strands, order 213456 |
Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) Similar in architecture to the superfamily II but partly differs in topology |
Family c.93.1.1: L-arabinose binding protein-like [53823] (18 proteins) has additional insertions and/or extensions that are not grouped together |
Protein Glucose-resistance amylase regulator CcpA, C-terminal domain [117740] (2 species) |
Species Bacillus megaterium [TaxId:1404] [117741] (10 PDB entries) Uniprot P46828 58-322 ! Uniprot P46828 |
Domain d1sxia_: 1sxi A: [112149] complexed with mg |
PDB Entry: 1sxi (more details), 3 Å
SCOPe Domain Sequences for d1sxia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sxia_ c.93.1.1 (A:) Glucose-resistance amylase regulator CcpA, C-terminal domain {Bacillus megaterium [TaxId: 1404]} tttvgviipdisnifyaelargiediatmykyniilsnsdqnqdkelhllnnmlgkqvdg iifmsgnvteehveelkkspvpvvlaasiestnqipsvtidyeqaafdavqslidsghkn iafvsgtleepinhakkvkgykraltesglpvrdsyivegdytydsgieaveklleedek ptaifvgtdemalgvihgaqdrglnvpndleiigfdntrlstmvrpqltsvvqpmydiga vamrlltkymnketvdssivqlphriefrqstk
Timeline for d1sxia_: