SCOP 1.71: Domain d1sflb_: 1sfl B:

Lineage for d1sflb_ (1sfl B:)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (32 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (6 families)
   Common fold covers whole protein structure

5. Family c.1.10.1: Class I aldolase [51570] (12 proteins)
   the catalytic lysine forms schiff-base intermediate with substrate
   possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels

6. Protein Type I 3-dehydroquinate dehydratase [51586] (2 species)

7. Species Staphylococcus aureus [TaxId:1280] [117378] (2 PDB entries)

8. Domain d1sflb_: 1sfl B: [112078]

Details for d1sflb_

PDB Entry: 1sfl, 1.9 Å

PDB Description: 1.9A Crystal structure of Staphylococcus aureus type I 3-dehydroquinase, apo form

SCOP Domain Sequences for d1sflb_:

Sequence, based on SEQRES records:

>d1sflb_ c.1.10.1 (B:) Type I 3-dehydroquinate dehydratase {Staphylococcus aureus}
hvevvatitpqlsieetliqkinhridaidvlelridqfenvtvdqvaemitklkvmqds
fkllvtyrtklqggygqftndsylnlisdlaningidmidiewqadidiekhqriithlq
qynkeviishhnfestppldelqfiffkmqkfnpeyvklavmphnkndvlnllqamstfs
dtmdckvvgismsklglisrtaqgvfggaltygcigepqapgqidvtdlkaqvtly

Sequence, based on observed residues (ATOM records):

>d1sflb_ c.1.10.1 (B:) Type I 3-dehydroquinate dehydratase {Staphylococcus aureus}
hvevvatitpqlsieetliqkinhridaidvlelridqfenvtvdqvaemitklkdsfkl
lvtyrtklqggygqftndsylnlisdlaningidmidiewqadidiekhqriithlqqyn
keviishhnfestppldelqfiffkmqkfnpeyvklavmphnkndvlnllqamstfsdtm
dckvvgismsklglisrtaqgvfggaltygcigepqapgqidvtdlkaqvtly

Timeline for d1sflb_:

• d1sflb_ is new in SCOP 1.71
  
• d1sflb_ appears in SCOP 1.73
  
• d1sflb_ appears in the current release, SCOPe 2.08