PDB entry 1sfl

View 1sfl on RCSB PDB site
Description: 1.9A Crystal structure of Staphylococcus aureus type I 3-dehydroquinase, apo form
Deposited on 2004-02-20, released 2004-10-19
The last revision prior to the SCOP 1.71 freeze date was dated 2004-10-19, with a file datestamp of 2004-10-19.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.23
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1sfla_
  • Chain 'B':
    Domains in SCOP 1.71: d1sflb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sflA (A:)
    mthvevvatitpqlsieetliqkinhridaidvlelridqfenvtvdqvaemitklkvmq
    dsfkllvtyrtklqggygqftndsylnlisdlaningidmidiewqadidiekhqriith
    lqqynkeviishhnfestppldelqfiffkmqkfnpeyvklavmphnkndvlnllqamst
    fsdtmdckvvgismsklglisrtaqgvfggaltygcigepqapgqidvtdlkaqvtly
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sflA (A:)
    hvevvatitpqletliqkinhridaidvlelridqfenvtvdqvaemitklkdsfkllvt
    yrtklqggygqftndsylnlisdlaningidmidiewqadidiekhqriithlqqynkev
    iishhnfestppldelqfiffkmqkfnpeyvklavmphnkndvlnllqamstfsdtmdck
    vvgismsklglisrtaqgvfggaltygcigepqapgqidvtdlkaqvtly
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1sflB (B:)
    mthvevvatitpqlsieetliqkinhridaidvlelridqfenvtvdqvaemitklkvmq
    dsfkllvtyrtklqggygqftndsylnlisdlaningidmidiewqadidiekhqriith
    lqqynkeviishhnfestppldelqfiffkmqkfnpeyvklavmphnkndvlnllqamst
    fsdtmdckvvgismsklglisrtaqgvfggaltygcigepqapgqidvtdlkaqvtly
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sflB (B:)
    hvevvatitpqlsieetliqkinhridaidvlelridqfenvtvdqvaemitklkdsfkl
    lvtyrtklqggygqftndsylnlisdlaningidmidiewqadidiekhqriithlqqyn
    keviishhnfestppldelqfiffkmqkfnpeyvklavmphnkndvlnllqamstfsdtm
    dckvvgismsklglisrtaqgvfggaltygcigepqapgqidvtdlkaqvtly