![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.34: Homo-oligomeric flavin-containing Cys decarboxylases, HFCD [52506] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
![]() | Superfamily c.34.1: Homo-oligomeric flavin-containing Cys decarboxylases, HFCD [52507] (2 families) ![]() |
![]() | Family c.34.1.1: Homo-oligomeric flavin-containing Cys decarboxylases, HFCD [52508] (4 proteins) Pfam PF02441; formerly DFP, DNA/pantothenate metabolism flavoprotein family |
![]() | Protein Probable aromatic acid decarboxylase Pad1 [117500] (1 species) |
![]() | Species Escherichia coli O157:H7 [TaxId:83334] [117501] (1 PDB entry) Uniprot Q9X728 |
![]() | Domain d1sbzd_: 1sbz D: [112071] complexed with fmn |
PDB Entry: 1sbz (more details), 2 Å
SCOPe Domain Sequences for d1sbzd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sbzd_ c.34.1.1 (D:) Probable aromatic acid decarboxylase Pad1 {Escherichia coli O157:H7 [TaxId: 83334]} mklivgmtgatgaplgvallqalrempnvethlvmskwakttieletpysardvaaladf shnpadqaatissgsfrtdgmivipcsmktlagiragyadglvgraadvvlkegrklvlv premplstihlenmlalsrmgvamvppmpafynhpetvddivhhvvarvldqfglehpya rrwqg
Timeline for d1sbzd_: