Lineage for d1s5ja1 (1s5j A:40-449)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2122050Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2123751Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) (S)
    consists of one domain of this fold
  5. 2124334Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (17 protein domains)
    contains Pfam PF00929
  6. 2124346Protein Exonuclease domain of family B DNA polymerases [53125] (8 species)
    elaborated with additional structures and the N-terminal subdomain
  7. 2124492Species Sulfolobus solfataricus [TaxId:2287] [117647] (1 PDB entry)
    Uniprot P26811 40-864
  8. 2124493Domain d1s5ja1: 1s5j A:40-449 [112040]
    Other proteins in same PDB: d1s5ja2
    complexed with mg, so4

Details for d1s5ja1

PDB Entry: 1s5j (more details), 2.4 Å

PDB Description: Insight in DNA Replication: The crystal structure of DNA Polymerase B1 from the archaeon Sulfolobus solfataricus
PDB Compounds: (A:) DNA polymerase I

SCOPe Domain Sequences for d1s5ja1:

Sequence, based on SEQRES records: (download)

>d1s5ja1 c.55.3.5 (A:40-449) Exonuclease domain of family B DNA polymerases {Sulfolobus solfataricus [TaxId: 2287]}
ewleeaqenkiyfllqvdydgkkgkavcklfdketqkiyalydntghkpyflvdlepdkv
gkipkivrdpsfdhietvskidpytwnkfkltkivvrdplavrrlrndvpkayeahikyf
nnymydiglipgmpyvvkngklesvylsldekdveeikkafadsdemtrqmavdwlpife
teipkikrvaidievytpvkgripdsqkaefpiisialagsdglkkvlvlnrndvnegsv
kldgisverfnteyellgrffdilleypivltfngddfdlpyiyfralklgyfpeeipid
vagkdeakylaglhidlykfffnkavrnyafegkyneynldavakallgtskvkvdtlis
fldveklieynfrdaeitlqlttfnndltmklivlfsrisrlgieeltrt

Sequence, based on observed residues (ATOM records): (download)

>d1s5ja1 c.55.3.5 (A:40-449) Exonuclease domain of family B DNA polymerases {Sulfolobus solfataricus [TaxId: 2287]}
ewleeaqenkiyfllqvdydgkkgkavcklfdketqkiyalydntghkpyflvdlepdkv
gkipkivrdpsfdhietvskidpytwnkfkltkivvrdplavrrlrndvpkayeahikyf
nnymydiglipgmpyvvkngklesvylsldekdveeikkafadsdemtrqmavdwlpife
teipkikrvaidievytpvkgripdsqkaefpiisialagsdglkkvlvlnrndvnegsv
kldgisverfnteyellgrffdilleypivltfngddfdlpyiyfralklgyfpeeipid
vagkdeakylaglhidlykfffnkavrnyafegkyneynldavakallgtskvdtlisfl
dveklieynfrdaeitlqlttfnndltmklivlfsrisrlgieeltrt

SCOPe Domain Coordinates for d1s5ja1:

Click to download the PDB-style file with coordinates for d1s5ja1.
(The format of our PDB-style files is described here.)

Timeline for d1s5ja1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1s5ja2