Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) consists of one domain of this fold |
Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (17 proteins) contains Pfam PF00929 |
Protein Exonuclease domain of family B DNA polymerases [53125] (8 species) elaborated with additional structures and the N-terminal subdomain |
Species Sulfolobus solfataricus [TaxId:2287] [117647] (1 PDB entry) Uniprot P26811 40-864 |
Domain d1s5ja1: 1s5j A:40-449 [112040] Other proteins in same PDB: d1s5ja2 complexed with mg, so4 has additional subdomain(s) that are not in the common domain |
PDB Entry: 1s5j (more details), 2.4 Å
SCOPe Domain Sequences for d1s5ja1:
Sequence, based on SEQRES records: (download)
>d1s5ja1 c.55.3.5 (A:40-449) Exonuclease domain of family B DNA polymerases {Sulfolobus solfataricus [TaxId: 2287]} ewleeaqenkiyfllqvdydgkkgkavcklfdketqkiyalydntghkpyflvdlepdkv gkipkivrdpsfdhietvskidpytwnkfkltkivvrdplavrrlrndvpkayeahikyf nnymydiglipgmpyvvkngklesvylsldekdveeikkafadsdemtrqmavdwlpife teipkikrvaidievytpvkgripdsqkaefpiisialagsdglkkvlvlnrndvnegsv kldgisverfnteyellgrffdilleypivltfngddfdlpyiyfralklgyfpeeipid vagkdeakylaglhidlykfffnkavrnyafegkyneynldavakallgtskvkvdtlis fldveklieynfrdaeitlqlttfnndltmklivlfsrisrlgieeltrt
>d1s5ja1 c.55.3.5 (A:40-449) Exonuclease domain of family B DNA polymerases {Sulfolobus solfataricus [TaxId: 2287]} ewleeaqenkiyfllqvdydgkkgkavcklfdketqkiyalydntghkpyflvdlepdkv gkipkivrdpsfdhietvskidpytwnkfkltkivvrdplavrrlrndvpkayeahikyf nnymydiglipgmpyvvkngklesvylsldekdveeikkafadsdemtrqmavdwlpife teipkikrvaidievytpvkgripdsqkaefpiisialagsdglkkvlvlnrndvnegsv kldgisverfnteyellgrffdilleypivltfngddfdlpyiyfralklgyfpeeipid vagkdeakylaglhidlykfffnkavrnyafegkyneynldavakallgtskvdtlisfl dveklieynfrdaeitlqlttfnndltmklivlfsrisrlgieeltrt
Timeline for d1s5ja1: