Lineage for d1rzwa_ (1rzw A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1631314Fold c.131: Peptidyl-tRNA hydrolase II [102461] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 4 strands, order 2143, strand 4 is antiparallel to the rest
  4. 1631315Superfamily c.131.1: Peptidyl-tRNA hydrolase II [102462] (2 families) (S)
  5. 1631316Family c.131.1.1: Peptidyl-tRNA hydrolase II [102463] (5 proteins)
    Pfam PF01981; UPF0099
  6. 1631321Protein Hypothetical protein AF2095 [117608] (1 species)
  7. 1631322Species Archaeoglobus fulgidus [TaxId:2234] [117609] (1 PDB entry)
    Uniprot O28185
  8. 1631323Domain d1rzwa_: 1rzw A: [112001]
    Structural genomics target

Details for d1rzwa_

PDB Entry: 1rzw (more details)

PDB Description: the solution structure of the archaeglobus fulgidis protein af2095. northeast structural genomics consortium target gr4
PDB Compounds: (A:) Protein AF2095(GR4)

SCOPe Domain Sequences for d1rzwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rzwa_ c.131.1.1 (A:) Hypothetical protein AF2095 {Archaeoglobus fulgidus [TaxId: 2234]}
mtlkqvivvrddlklsrgklavqvahaaiigylksdsslrrkwldegqkkvvlkvkslee
llgikhkaeslglvtglvqdagltevppgtitavvigpdeerkidkvtgnlpllklehhh
hhh

SCOPe Domain Coordinates for d1rzwa_:

Click to download the PDB-style file with coordinates for d1rzwa_.
(The format of our PDB-style files is described here.)

Timeline for d1rzwa_: