![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.131: Peptidyl-tRNA hydrolase II [102461] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 4 strands, order 2143, strand 4 is antiparallel to the rest |
![]() | Superfamily c.131.1: Peptidyl-tRNA hydrolase II [102462] (2 families) ![]() |
![]() | Family c.131.1.1: Peptidyl-tRNA hydrolase II [102463] (5 proteins) Pfam PF01981; UPF0099 |
![]() | Protein Hypothetical protein AF2095 [117608] (1 species) |
![]() | Species Archaeoglobus fulgidus [TaxId:2234] [117609] (1 PDB entry) Uniprot O28185 |
![]() | Domain d1rzwa1: 1rzw A:1-115 [112001] Other proteins in same PDB: d1rzwa2 Structural genomics target |
PDB Entry: 1rzw (more details)
SCOPe Domain Sequences for d1rzwa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rzwa1 c.131.1.1 (A:1-115) Hypothetical protein AF2095 {Archaeoglobus fulgidus [TaxId: 2234]} mtlkqvivvrddlklsrgklavqvahaaiigylksdsslrrkwldegqkkvvlkvkslee llgikhkaeslglvtglvqdagltevppgtitavvigpdeerkidkvtgnlpllk
Timeline for d1rzwa1: