Lineage for d1rzod2 (1rzo D:2136-2262)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2401196Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2401663Superfamily b.42.2: Ricin B-like lectins [50370] (4 families) (S)
  5. 2401664Family b.42.2.1: Ricin B-like [50371] (11 proteins)
  6. 2401750Protein Plant cytotoxin B-chain (lectin) [50372] (5 species)
    duplication: consists of two domains of this fold
  7. 2401754Species Castor bean (Ricinus communis), Ricin [TaxId:3988] [50373] (3 PDB entries)
    Uniprot P06750 303-564
  8. 2401762Domain d1rzod2: 1rzo D:2136-2262 [111988]
    Other proteins in same PDB: d1rzoa_, d1rzoc_
    complexed with gal, so4

Details for d1rzod2

PDB Entry: 1rzo (more details), 2.63 Å

PDB Description: agglutinin from ricinus communis with galactoaza
PDB Compounds: (D:) agglutinin

SCOPe Domain Sequences for d1rzod2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rzod2 b.42.2.1 (D:2136-2262) Plant cytotoxin B-chain (lectin) {Castor bean (Ricinus communis), Ricin [TaxId: 3988]}
ntqpfvttivglygmclqansgkvwledctsekaeqqwalyadgsirpqqnrdnclttda
nikgtvvkilscgpassgqrwmfkndgtilnlynglvldvrrsdpslkqiivhpfhgnln
qiwlplf

SCOPe Domain Coordinates for d1rzod2:

Click to download the PDB-style file with coordinates for d1rzod2.
(The format of our PDB-style files is described here.)

Timeline for d1rzod2: