![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily) contains mixed beta-sheet |
![]() | Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (3 families) ![]() |
![]() | Family d.165.1.1: Plant cytotoxins [56372] (18 proteins) |
![]() | Protein Ricin A-chain [56389] (1 species) |
![]() | Species Castor bean (Ricinus communis) [TaxId:3988] [56390] (55 PDB entries) Uniprot P06750 28-286 |
![]() | Domain d1rzoa_: 1rzo A: [111983] Other proteins in same PDB: d1rzob1, d1rzob2, d1rzod1, d1rzod2 complexed with gal, so4 |
PDB Entry: 1rzo (more details), 2.63 Å
SCOPe Domain Sequences for d1rzoa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rzoa_ d.165.1.1 (A:) Ricin A-chain {Castor bean (Ricinus communis) [TaxId: 3988]} kqypiinfttadatvesytnfiravrshlttgadvrheipvlpnrvglpisqrfilvels nhaelsvtlaldvtnayvvgcragnsayffhpdnqedaeaithlftdvqnsftfafggny drleqlgglrenielgtgpledaisalyyystcgtqiptlarsfmvciqmiseaarfqyi egemrtrirynrrsapdpsvitlenswgrlstaiqesnqgafaspiqlqrrngskfnvyd vsilipiialmvyrcappp
Timeline for d1rzoa_: