Lineage for d1rzod1 (1rzo D:2001-2135)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1543030Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 1543418Superfamily b.42.2: Ricin B-like lectins [50370] (4 families) (S)
  5. 1543419Family b.42.2.1: Ricin B-like [50371] (11 proteins)
  6. 1543501Protein Plant cytotoxin B-chain (lectin) [50372] (5 species)
    duplication: consists of two domains of this fold
  7. 1543505Species Castor bean (Ricinus communis), Ricin [TaxId:3988] [50373] (3 PDB entries)
    Uniprot P06750 303-564
  8. 1543512Domain d1rzod1: 1rzo D:2001-2135 [111987]
    Other proteins in same PDB: d1rzoa_, d1rzoc_
    complexed with gal, so4

Details for d1rzod1

PDB Entry: 1rzo (more details), 2.63 Å

PDB Description: agglutinin from ricinus communis with galactoaza
PDB Compounds: (D:) agglutinin

SCOPe Domain Sequences for d1rzod1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rzod1 b.42.2.1 (D:2001-2135) Plant cytotoxin B-chain (lectin) {Castor bean (Ricinus communis), Ricin [TaxId: 3988]}
advcmdpepivrivgrnglcvdvtgeeffdgnpiqlwpcksntdwnqlwtlrkdstirsn
gkcltiskssprqqvviyncstatvgatrwqiwdnrtiinprsglvlaatsgnsgtkltv
qtniyavsqgwlptn

SCOPe Domain Coordinates for d1rzod1:

Click to download the PDB-style file with coordinates for d1rzod1.
(The format of our PDB-style files is described here.)

Timeline for d1rzod1: