Lineage for d1rzod1 (1rzo D:2001-2135)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 560566Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 560747Superfamily b.42.2: Ricin B-like lectins [50370] (3 families) (S)
  5. 560748Family b.42.2.1: Ricin B-like [50371] (7 proteins)
  6. 560767Protein Plant cytotoxin B-chain (lectin) [50372] (5 species)
    duplication: consists of two domains of this fold
  7. 560771Species Castor bean (Ricinus communis), Ricin [TaxId:3988] [50373] (2 PDB entries)
  8. 560776Domain d1rzod1: 1rzo D:2001-2135 [111987]
    Other proteins in same PDB: d1rzoa_, d1rzoc_

Details for d1rzod1

PDB Entry: 1rzo (more details), 2.63 Å

PDB Description: agglutinin from ricinus communis with galactoaza

SCOP Domain Sequences for d1rzod1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rzod1 b.42.2.1 (D:2001-2135) Plant cytotoxin B-chain (lectin) {Castor bean (Ricinus communis), Ricin}
advcmdpepivrivgrnglcvdvtgeeffdgnpiqlwpcksntdwnqlwtlrkdstirsn
gkcltiskssprqqvviyncstatvgatrwqiwdnrtiinprsglvlaatsgnsgtkltv
qtniyavsqgwlptn

SCOP Domain Coordinates for d1rzod1:

Click to download the PDB-style file with coordinates for d1rzod1.
(The format of our PDB-style files is described here.)

Timeline for d1rzod1: