SCOP 1.73: Domain d1rwn.1: 1rwn A:,B:

Lineage for d1rwn.1 (1rwn A:,B:)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.17: Caspase-like [52128] (1 superfamily)
   3 layers, a/b/a; core: mixed beta-sheet of 6 strands, order 213456, strand 6 is antiparallel to the rest

4. Superfamily c.17.1: Caspase-like [52129] (2 families)
   mature protein may be composed of two chains folded in a single domain

5. Family c.17.1.1: Caspase catalytic domain [52130] (7 proteins)

6. Protein Interleukin-1beta converting enzyme (a cysteine protease) [52133] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52134] (14 PDB entries)

8. Domain d1rwn.1: 1rwn A:,B: [111948]
   complexed with 4qb

Details for d1rwn.1

PDB Entry: 1rwn, 2 Å

PDB Description: Crystal structure of human caspase-1 in complex with 3-{2-ethyl-6-[4-(quinoxalin-2-ylamino)-benzoylamino]-hexanoylamino}-4-oxo-butyric acid

PDB Compounds: (A:) Interleukin-1 beta convertase, (B:) Interleukin-1 beta convertase

SCOP Domain Sequences for d1rwn.1:

Sequence; same for both SEQRES and ATOM records:

>g1rwn.1 c.17.1.1 (A:,B:) Interleukin-1beta converting enzyme (a cysteine protease) {Human (Homo sapiens) [TaxId: 9606]}
tssgsegnvklcsleeaqriwkqksaeiypimdkssrtrlaliicneefdsiprrtgaev
ditgmtmllqnlgysvdvkknltasdmtteleafahrpehktsdstflvfmshgiregic
gkkhseqvpdilqlnaifnmlntkncpslkdkpkviiiqacrgdspgvvwfkdXaikkah
iekdfiafcsstpdnvswrhptmgsvfigrliehmqeyacscdveeifrkvrfsfeqpdg
raqmpttervtltrcfylfpgh

Timeline for d1rwn.1:

• d1rwn.1 first appeared in SCOP 1.71
  
• d1rwn.1 appears in SCOP 1.75
  
• d1rwn.1 appears in the current release, SCOPe 2.08