Lineage for d1rwn.1 (1rwn A:,B:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 578329Fold c.17: Caspase-like [52128] (1 superfamily)
    3 layers, a/b/a; core: mixed beta-sheet of 6 strands, order 213456, strand 6 is antiparallel to the rest
  4. 578330Superfamily c.17.1: Caspase-like [52129] (2 families) (S)
    mature protein may be composed of two chains folded in a single domain
  5. 578331Family c.17.1.1: Caspase catalytic domain [52130] (7 proteins)
  6. 578408Protein Interleukin-1beta converting enzyme (a cysteine protease) [52133] (1 species)
  7. 578409Species Human (Homo sapiens) [TaxId:9606] [52134] (14 PDB entries)
  8. 578412Domain d1rwn.1: 1rwn A:,B: [111948]
    complexed with 4qb

Details for d1rwn.1

PDB Entry: 1rwn (more details), 2 Å

PDB Description: Crystal structure of human caspase-1 in complex with 3-{2-ethyl-6-[4-(quinoxalin-2-ylamino)-benzoylamino]-hexanoylamino}-4-oxo-butyric acid

SCOP Domain Sequences for d1rwn.1:

Sequence; same for both SEQRES and ATOM records: (download)

>g1rwn.1 c.17.1.1 (A:,B:) Interleukin-1beta converting enzyme (a cysteine protease) {Human (Homo sapiens)}
tssgsegnvklcsleeaqriwkqksaeiypimdkssrtrlaliicneefdsiprrtgaev
ditgmtmllqnlgysvdvkknltasdmtteleafahrpehktsdstflvfmshgiregic
gkkhseqvpdilqlnaifnmlntkncpslkdkpkviiiqacrgdspgvvwfkdXaikkah
iekdfiafcsstpdnvswrhptmgsvfigrliehmqeyacscdveeifrkvrfsfeqpdg
raqmpttervtltrcfylfpgh

SCOP Domain Coordinates for d1rwn.1:

Click to download the PDB-style file with coordinates for d1rwn.1.
(The format of our PDB-style files is described here.)

Timeline for d1rwn.1: