SCOPe 2.07: Domain d1rkya2: 1rky A:43-169

Lineage for d1rkya2 (1rky A:43-169)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.2: Amine oxidase N-terminal region [54416] (2 families)

5. Family d.17.2.1: Amine oxidase N-terminal region [54417] (2 proteins)
   duplication: contains two domains of this fold

6. Protein Lysyl oxidase PplO, domains 1 and 2 [102806] (1 species)

7. Species Yeast (Pichia pastoris) [TaxId:4922] [102807] (3 PDB entries)
   Uniprot Q96X16 43-777

8. Domain d1rkya2: 1rky A:43-169 [111857]
   Other proteins in same PDB: d1rkya1
   complexed with ca, cl, cu, imd, mg, nag, xe

Details for d1rkya2

PDB Entry: 1rky, 1.68 Å

PDB Description: pplo + xe

PDB Compounds: (A:) lysyl oxidase

SCOPe Domain Sequences for d1rkya2:

Sequence; same for both SEQRES and ATOM records:

>d1rkya2 d.17.2.1 (A:43-169) Lysyl oxidase PplO, domains 1 and 2 {Yeast (Pichia pastoris) [TaxId: 4922]}
aecvsnenveieapktniwtslakeevqevldllhstynitevtkadffsnyvlwietlk
pnktealtyldedgdlpprnartvvyfgegeegyfeelkvgplpvsdettieplsfyntn
gksklpf

Timeline for d1rkya2:

• d1rkya2 first appeared in SCOP 1.71
  
• d1rkya2 appears in SCOPe 2.06
  
• d1rkya2 appears in the current release, SCOPe 2.08