Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.2: Amine oxidase N-terminal region [54416] (1 family) |
Family d.17.2.1: Amine oxidase N-terminal region [54417] (2 proteins) duplication: contains two domains of this fold |
Protein Lysyl oxidase PplO, domains 1 and 2 [102806] (1 species) |
Species Yeast (Pichia pastoris) [TaxId:4922] [102807] (2 PDB entries) |
Domain d1rkya2: 1rky A:43-169 [111857] Other proteins in same PDB: d1rkya1 |
PDB Entry: 1rky (more details), 1.68 Å
SCOP Domain Sequences for d1rkya2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rkya2 d.17.2.1 (A:43-169) Lysyl oxidase PplO, domains 1 and 2 {Yeast (Pichia pastoris)} aecvsnenveieapktniwtslakeevqevldllhstynitevtkadffsnyvlwietlk pnktealtyldedgdlpprnartvvyfgegeegyfeelkvgplpvsdettieplsfyntn gksklpf
Timeline for d1rkya2: