SCOPe 2.06: Domain d1rjzb1: 1rjz B:1-99

Lineage for d1rjzb1 (1rjz B:1-99)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein beta2-microglobulin [88600] (6 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88603] (182 PDB entries)
   Uniprot P01887

8. Domain d1rjzb1: 1rjz B:1-99 [111844]
   Other proteins in same PDB: d1rjza1, d1rjza2, d1rjzb2, d1rjzd1, d1rjzd2, d1rjze2
   mutant

Details for d1rjzb1

PDB Entry: 1rjz, 2.6 Å

PDB Description: mhc class i natural mutant h-2kbm8 heavy chain complexed with beta-2 microglobulin and herpies simplex virus mutant glycoprotein b peptide

PDB Compounds: (B:) Beta-2-microglobulin

SCOPe Domain Sequences for d1rjzb1:

Sequence; same for both SEQRES and ATOM records:

>d1rjzb1 b.1.1.2 (B:1-99) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

Timeline for d1rjzb1:

• d1rjzb1 first appeared in SCOP 1.71, called d1rjzb_
  
• d1rjzb1 was called d1rjzb_ in SCOPe 2.05
  
• d1rjzb1 appears in SCOPe 2.07
  
• d1rjzb1 appears in the current release, SCOPe 2.08