Lineage for d1rjzb_ (1rjz B:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 546419Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 548299Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 548300Protein beta2-microglobulin [88600] (4 species)
  7. 548438Species Mouse (Mus musculus) [TaxId:10090] [88603] (66 PDB entries)
  8. 548497Domain d1rjzb_: 1rjz B: [111844]
    Other proteins in same PDB: d1rjza1, d1rjza2, d1rjzd1, d1rjzd2

Details for d1rjzb_

PDB Entry: 1rjz (more details), 2.6 Å

PDB Description: Mhc Class I Natural Mutant H-2Kbm8 Heavy Chain Complexed With beta-2 Microglobulin and Herpies Simplex Virus Mutant Glycoprotein B Peptide

SCOP Domain Sequences for d1rjzb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rjzb_ b.1.1.2 (B:) beta2-microglobulin {Mouse (Mus musculus)}
miqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskd
wsfyilahteftptetdtyacrvkhdsmaepktvywdrdm

SCOP Domain Coordinates for d1rjzb_:

Click to download the PDB-style file with coordinates for d1rjzb_.
(The format of our PDB-style files is described here.)

Timeline for d1rjzb_: