Lineage for d1rjoa1 (1rjo A:212-628)
- Root: SCOP 1.71
Class b: All beta proteins [48724] (149 folds) 
Fold b.30: Supersandwich [49993] (3 superfamilies)
sandwich; 18 strands in 2 sheets
Superfamily b.30.2: Amine oxidase catalytic domain [49998] (1 family) 
Family b.30.2.1: Amine oxidase catalytic domain [49999] (2 proteins) 
Protein Copper amine oxidase, domain 3 [50000] (4 species) Species Arthrobacter globiformis [TaxId:1665] [50003] (15 PDB entries) 
Domain d1rjoa1: 1rjo A:212-628 [111832]
Other proteins in same PDB: d1rjoa2, d1rjoa3
complexed with cu, gol, na, so4, xe
Details for d1rjoa1
PDB Entry: 1rjo (more details), 1.67 Å
PDB Description: agao + xe
SCOP Domain Sequences for d1rjoa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rjoa1 b.30.2.1 (A:212-628) Copper amine oxidase, domain 3 {Arthrobacter globiformis}
plrttqkpisitqpegpsftvtggnhiewekwsldvgfdvregvvlhniafrdgdrlrpi
inrasiaemvvpygdpspirswqnyfdtgeylvgqyanslelgcdclgditylspvisda
fgnpreirngicmheedwgilakhsdlwsginytrrnrrmvisffttignadygfywyly
ldgtiefeakatgvvftsafpeggsdnisqlapglgapfhqhifsarldmaidgftnrve
eedvvrqtmgpgnergnafsrkrtvltreseavreadartgrtwiisnpesknrlnepvg
yklhahnqptlladpgssiarraafatkdlwvtryadderyptgdfvnqhsggaglpsyi
aqdrdidgqdivvwhtfglthfprvedwpimpvdtvgfklrpegffdrspvldvpan
SCOP Domain Coordinates for d1rjoa1:
Click to download the PDB-style file with coordinates for d1rjoa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1rjoa1:
- d1rjoa1 is new in SCOP 1.71
- d1rjoa1 appears in SCOP 1.73
- d1rjoa1 appears in the current release, SCOPe 2.08
View in 3D
