PDB entry 1rjo

View 1rjo on RCSB PDB site
Description: agao + xe
Deposited on 2003-11-19, released 2004-12-07
The last revision prior to the SCOP 1.71 freeze date was dated 2004-12-07, with a file datestamp of 2004-12-07.
Experiment type: XRAY
Resolution: 1.67 Å
R-factor: 0.158
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rjoA (A:)
    pstiqtaspfrlasageisevqgilrtagllgpekriaylgvldpargagseaedrrfrv
    fihdvsgarpqevtvsvtngtvisaveldtaatgelpvleeefevveqllatderwlkal
    aarnldvskvrvaplsagvfeyaeergrrilrglafvqdfpedsawahpvdglvayvdvv
    skevtrvidtgvfpvpaehgnytdpeltgplrttqkpisitqpegpsftvtggnhiewek
    wsldvgfdvregvvlhniafrdgdrlrpiinrasiaemvvpygdpspirswqnyfdtgey
    lvgqyanslelgcdclgditylspvisdafgnpreirngicmheedwgilakhsdlwsgi
    nytrrnrrmvisffttignadygfywylyldgtiefeakatgvvftsafpeggsdnisql
    apglgapfhqhifsarldmaidgftnrveeedvvrqtmgpgnergnafsrkrtvltrese
    avreadartgrtwiisnpesknrlnepvgyklhahnqptlladpgssiarraafatkdlw
    vtryadderyptgdfvnqhsggaglpsyiaqdrdidgqdivvwhtfglthfprvedwpim
    pvdtvgfklrpegffdrspvldvpanpsqsgshchgsnwshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rjoA (A:)
    aspfrlasageisevqgilrtagllgpekriaylgvldpargagseaedrrfrvfihdvs
    garpqevtvsvtngtvisaveldtaatgelpvleeefevveqllatderwlkalaarnld
    vskvrvaplsagvfeyaeergrrilrglafvqdfpedsawahpvdglvayvdvvskevtr
    vidtgvfpvpaehgnytdpeltgplrttqkpisitqpegpsftvtggnhiewekwsldvg
    fdvregvvlhniafrdgdrlrpiinrasiaemvvpygdpspirswqnyfdtgeylvgqya
    nslelgcdclgditylspvisdafgnpreirngicmheedwgilakhsdlwsginytrrn
    rrmvisffttignadygfywylyldgtiefeakatgvvftsafpeggsdnisqlapglga
    pfhqhifsarldmaidgftnrveeedvvrqtmgpgnergnafsrkrtvltreseavread
    artgrtwiisnpesknrlnepvgyklhahnqptlladpgssiarraafatkdlwvtryad
    deryptgdfvnqhsggaglpsyiaqdrdidgqdivvwhtfglthfprvedwpimpvdtvg
    fklrpegffdrspvldvpan