Lineage for d1rjoa3 (1rjo A:97-211)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 599696Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 599780Superfamily d.17.2: Amine oxidase N-terminal region [54416] (1 family) (S)
  5. 599781Family d.17.2.1: Amine oxidase N-terminal region [54417] (2 proteins)
    duplication: contains two domains of this fold
  6. 599782Protein Copper amine oxidase, domains 1 and 2 [54418] (4 species)
  7. 599783Species Arthrobacter globiformis [TaxId:1665] [54421] (15 PDB entries)
  8. 599785Domain d1rjoa3: 1rjo A:97-211 [111834]
    Other proteins in same PDB: d1rjoa1
    complexed with cu, gol, na, so4, xe

Details for d1rjoa3

PDB Entry: 1rjo (more details), 1.67 Å

PDB Description: agao + xe

SCOP Domain Sequences for d1rjoa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rjoa3 d.17.2.1 (A:97-211) Copper amine oxidase, domains 1 and 2 {Arthrobacter globiformis}
elpvleeefevveqllatderwlkalaarnldvskvrvaplsagvfeyaeergrrilrgl
afvqdfpedsawahpvdglvayvdvvskevtrvidtgvfpvpaehgnytdpeltg

SCOP Domain Coordinates for d1rjoa3:

Click to download the PDB-style file with coordinates for d1rjoa3.
(The format of our PDB-style files is described here.)

Timeline for d1rjoa3: