Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.3: L30e-like [55315] (4 families) |
Family d.79.3.1: L30e/L7ae ribosomal proteins [55316] (4 proteins) |
Protein Ribosomal protein L7ae [55319] (7 species) |
Species Methanococcus jannaschii [TaxId:2190] [111033] (3 PDB entries) Uniprot P54066 |
Domain d1ra4a_: 1ra4 A: [111758] |
PDB Entry: 1ra4 (more details), 1.86 Å
SCOPe Domain Sequences for d1ra4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ra4a_ d.79.3.1 (A:) Ribosomal protein L7ae {Methanococcus jannaschii [TaxId: 2190]} mavyvkfkvpeeiqkelldavakaqkikkganevtkavergiaklviiaedvkpeevvah lpylceekgipyayvaskqdlgkaaglevaassvaiinegdaeelkvliekvnvlkq
Timeline for d1ra4a_: