Lineage for d1ra4a_ (1ra4 A:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 606051Fold d.79: Bacillus chorismate mutase-like [55297] (7 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 606212Superfamily d.79.3: L30e-like [55315] (3 families) (S)
  5. 606213Family d.79.3.1: L30e/L7ae ribosomal proteins [55316] (3 proteins)
  6. 606230Protein Ribosomal protein L7ae [55319] (4 species)
  7. 606254Species Archaeon Methanococcus jannaschii [TaxId:2190] [111033] (2 PDB entries)
  8. 606255Domain d1ra4a_: 1ra4 A: [111758]

Details for d1ra4a_

PDB Entry: 1ra4 (more details), 1.86 Å

PDB Description: Crystal structure of the Methanococcus jannaschii L7Ae protein

SCOP Domain Sequences for d1ra4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ra4a_ d.79.3.1 (A:) Ribosomal protein L7ae {Archaeon Methanococcus jannaschii}
mavyvkfkvpeeiqkelldavakaqkikkganevtkavergiaklviiaedvkpeevvah
lpylceekgipyayvaskqdlgkaaglevaassvaiinegdaeelkvliekvnvlkq

SCOP Domain Coordinates for d1ra4a_:

Click to download the PDB-style file with coordinates for d1ra4a_.
(The format of our PDB-style files is described here.)

Timeline for d1ra4a_: