Lineage for d1r7ma2 (1r7m A:121-225)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2572655Fold d.95: Homing endonuclease-like [55603] (2 superfamilies)
    alpha-beta(2)-alpha-beta(2)-alpha; 2 layers: a/b; antiparallel sheet 1243
  4. 2572666Superfamily d.95.2: Homing endonucleases [55608] (3 families) (S)
  5. 2572667Family d.95.2.1: Group I mobile intron endonuclease [55609] (6 proteins)
    contains two extra helices in the C-terminal extension
  6. 2572717Protein DNA endonuclease I-SceI [118055] (1 species)
    duplication: contains tandem repeat of this fold
  7. 2572718Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [118056] (1 PDB entry)
    Uniprot P03882
  8. 2572720Domain d1r7ma2: 1r7m A:121-225 [111714]
    protein/DNA complex; complexed with ca

Details for d1r7ma2

PDB Entry: 1r7m (more details), 2.25 Å

PDB Description: The homing endonuclease I-SceI bound to its DNA recognition region
PDB Compounds: (A:) Intron-encoded endonuclease I-SceI

SCOPe Domain Sequences for d1r7ma2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r7ma2 d.95.2.1 (A:121-225) DNA endonuclease I-SceI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kktipnnlvenyltpmslaywfmddggkwdynknstnksivlntqsftfeeveylvkglr
nkfqlncyvkinknkpiiyidsmsylifynlikpylipqmmyklp

SCOPe Domain Coordinates for d1r7ma2:

Click to download the PDB-style file with coordinates for d1r7ma2.
(The format of our PDB-style files is described here.)

Timeline for d1r7ma2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1r7ma1