Lineage for d1r5ka_ (1r5k A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008476Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2008477Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2008478Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 protein domains)
  6. 2008578Protein Estrogen receptor alpha [48519] (1 species)
  7. 2008579Species Human (Homo sapiens) [TaxId:9606] [48520] (63 PDB entries)
    Uniprot P03372 307-551
  8. 2008678Domain d1r5ka_: 1r5k A: [111706]
    protein/DNA complex; complexed with gw5

Details for d1r5ka_

PDB Entry: 1r5k (more details), 2.7 Å

PDB Description: Human Estrogen Receptor alpha Ligand-Binding Domain In Complex With GW5638
PDB Compounds: (A:) Estrogen receptor

SCOPe Domain Sequences for d1r5ka_:

Sequence, based on SEQRES records: (download)

>d1r5ka_ a.123.1.1 (A:) Estrogen receptor alpha {Human (Homo sapiens) [TaxId: 9606]}
lalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakrvp
gfvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmveif
dmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvldkitdt
lihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvplydlllemld

Sequence, based on observed residues (ATOM records): (download)

>d1r5ka_ a.123.1.1 (A:) Estrogen receptor alpha {Human (Homo sapiens) [TaxId: 9606]}
lalsltadqmvsalldaeppilyseydfseasmmglltnladrelvhminwakrvpgfvd
ltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmveifdmll
atssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvldkitdtlihl
makagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvplydlllemld

SCOPe Domain Coordinates for d1r5ka_:

Click to download the PDB-style file with coordinates for d1r5ka_.
(The format of our PDB-style files is described here.)

Timeline for d1r5ka_: