![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) ![]() |
![]() | Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (16 proteins) Common fold covers whole protein structure |
![]() | Protein 20alpha-hydroxysteroid dehydrogenase [109609] (2 species) |
![]() | Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [110348] (2 PDB entries) Uniprot P80508 |
![]() | Domain d1q13a_: 1q13 A: [111648] complexed with nap, so4, tes |
PDB Entry: 1q13 (more details), 2.08 Å
SCOPe Domain Sequences for d1q13a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1q13a_ c.1.7.1 (A:) 20alpha-hydroxysteroid dehydrogenase {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} dpkfqrvalsdghfipvlgfgtyapeevpkskameatkiaidagfrhidsayfyknekev glairskiadgtvkredifytsklwctfhrpelvrpsledslknlqldyvdlyiihfpta lkpgveiiptdehgkaifdtvdicatweamekckdaglaksigvsnfnrrqlemilnkpg lkykpvcnqvechpylnqgkllefckskgivlvaysalgshrepewvdqsapvlledpli galakkhqqtpalialryqlqrgivvlaksftekrikeniqvfefqlpsedmkvidslnr nfryvtadfaighpnypfsdey
Timeline for d1q13a_: