SCOPe 2.08: Domain d1q13a_: 1q13 A:

Lineage for d1q13a_ (1q13 A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families)

5. Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (16 proteins)
   Common fold covers whole protein structure

6. Protein 20alpha-hydroxysteroid dehydrogenase [109609] (2 species)

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [110348] (2 PDB entries)
   Uniprot P80508

8. Domain d1q13a_: 1q13 A: [111648]
   complexed with nap, so4, tes

Details for d1q13a_

PDB Entry: 1q13, 2.08 Å

PDB Description: crystal structure of rabbit 20alpha hyroxysteroid dehydrogenase in ternary complex with nadp and testosterone

PDB Compounds: (A:) Prostaglandin-E2 9-reductase

SCOPe Domain Sequences for d1q13a_:

Sequence; same for both SEQRES and ATOM records:

>d1q13a_ c.1.7.1 (A:) 20alpha-hydroxysteroid dehydrogenase {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
dpkfqrvalsdghfipvlgfgtyapeevpkskameatkiaidagfrhidsayfyknekev
glairskiadgtvkredifytsklwctfhrpelvrpsledslknlqldyvdlyiihfpta
lkpgveiiptdehgkaifdtvdicatweamekckdaglaksigvsnfnrrqlemilnkpg
lkykpvcnqvechpylnqgkllefckskgivlvaysalgshrepewvdqsapvlledpli
galakkhqqtpalialryqlqrgivvlaksftekrikeniqvfefqlpsedmkvidslnr
nfryvtadfaighpnypfsdey

Timeline for d1q13a_:

• d1q13a_ first appeared in SCOP 1.71
  
• d1q13a_ appears in SCOPe 2.07